Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b)

This Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 109B

UniProt

Q810S1

Expression Region

1-345

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGALSGRRMLPSGLCLGRWQLLRTIRARGRGDPRELPSTPQVLCMKLYGNPKYHQALHY GTVEPQDEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAA IITADGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEEPSGEHMTELENTKSLVHRL FTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEARSEANTSGLLWAGLALLSVQ GGALAWLTWWVYSWDIMEPVTFFLSFANSIVFFAYFIITRQNYTYSSLRSRQFLQFFHKK SQRRCFDVEQYNKLKEDLAEATESLESVRRSLRLRIQGEEASEKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HBD shRNA (UAS) - Lentiviral human HBD shRNA (UAS, GFP) (25)
GTR15095168 1 Vial

Lentiviral human HBD shRNA (UAS) - Lentiviral human HBD shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal Rabbit anti-Goat IgG (H+L) Secondary Antibody [HRP] (Pre-absorbed)
NB7376 1 mL

Rabbit Polyclonal Rabbit anti-Goat IgG (H+L) Secondary Antibody [HRP] (Pre-absorbed)

Sign In for Pricing
View Details
GGA1 Peptide - N-terminal region
orb2007753 100 µg

GGA1 Peptide - N-terminal region

Sign In for Pricing
View Details
MerTK Monoclonal Antibody
BT-MCA0882-01 50 µL

MerTK Monoclonal Antibody

Sign In for Pricing
View Details
MerTK Monoclonal Antibody
BT-MCA0882-02 100 µL

MerTK Monoclonal Antibody

Sign In for Pricing
View Details
DMGDH (E-6) Alexa Fluor® 790
sc-393178 AF790 200 µg/mL

DMGDH (E-6) Alexa Fluor® 790

Sign In for Pricing
View Details