Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b)

This Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 109B

UniProt

Q810S1

Expression Region

1-345

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGALSGRRMLPSGLCLGRWQLLRTIRARGRGDPRELPSTPQVLCMKLYGNPKYHQALHY GTVEPQDEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAA IITADGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEEPSGEHMTELENTKSLVHRL FTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEARSEANTSGLLWAGLALLSVQ GGALAWLTWWVYSWDIMEPVTFFLSFANSIVFFAYFIITRQNYTYSSLRSRQFLQFFHKK SQRRCFDVEQYNKLKEDLAEATESLESVRRSLRLRIQGEEASEKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBD3L3 Double Nickase Plasmid (h)
sc-417976-NIC 20 µg

MBD3L3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Anti-active + pro Caspase 3 CASP3 Rabbit Monoclonal Antibody, Carrier-free
M00334-4-carrier-free 100 µL

Anti-active + pro Caspase 3 CASP3 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Anti-gD (HSV-1) Polyclonal Antibody, rabbit IgG
MBS432010-01 0.1 mg

Anti-gD (HSV-1) Polyclonal Antibody, rabbit IgG

Sign In for Pricing
View Details
Anti-gD (HSV-1) Polyclonal Antibody, rabbit IgG
MBS432010-02 5x 0.1 mg

Anti-gD (HSV-1) Polyclonal Antibody, rabbit IgG

Sign In for Pricing
View Details
Atm (Acetyl Lys316) rabbit pAb
UB-GEN-13900 100 µL

Atm (Acetyl Lys316) rabbit pAb

Sign In for Pricing
View Details
KPNA4 ORF Vector (Human) (pORF)
25903011 1.0 µg DNA

KPNA4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details