Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS)

This Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Sensor histidine kinase graS, EC= 2.7.13.3, Glycopeptide resistance-associated protein S

UniProt

A5IQL3

Expression Region

1-346

Origin

Staphylococcus aureus (strain JH9)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLIL TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDTKWCRMIIRQILSNALK YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BTLA sgRNA gene knockout kit - Lentiviral human BTLA sgRNA gene knockout kit (100)
GTR15376105 1 Vial

Lentiviral human BTLA sgRNA gene knockout kit - Lentiviral human BTLA sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
IRS1 (11O6) Mouse Monoclonal antibody
E28PE2684 100 µL

IRS1 (11O6) Mouse Monoclonal antibody

Sign In for Pricing
View Details
RPS24P15 CRISPRa sgRNA lentivector (set of three targets)(Human)
42269121 3x 1.0µg DNA

RPS24P15 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
PPP1R2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
37430126 3x 1.0µg DNA

PPP1R2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Krtcap3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
26226116 3x 1.0 µg

Krtcap3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CAPZA1 Recombinant Mouse mAb
E47M60379 100 µL

CAPZA1 Recombinant Mouse mAb

Sign In for Pricing
View Details