Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS)

This Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Sensor histidine kinase graS, EC= 2.7.13.3, Glycopeptide resistance-associated protein S

UniProt

A7WZC5

Expression Region

1-346

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLIL TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDTKWCRMIIRQILSNALK YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDE12 activation kit by CRISPRa
GA116401 1 Kit

Human PDE12 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant ADK Monoclonal Antibody
AN301852L-01 50 µL

Recombinant ADK Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ADK Monoclonal Antibody
AN301852L-02 100 µL

Recombinant ADK Monoclonal Antibody

Sign In for Pricing
View Details
ARRDC2 (NM_001025604) Human Over-expression Lysate
LC422456 20 µg

ARRDC2 (NM_001025604) Human Over-expression Lysate

Sign In for Pricing
View Details
IRAK4 (2-13) Goat Polyclonal Antibody
AP23599PU-N 50 µg

IRAK4 (2-13) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS702509 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details