Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS)

This Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Sensor histidine kinase graS, EC= 2.7.13.3, Glycopeptide resistance-associated protein S

UniProt

Q2G0D9

Expression Region

1-346

Origin

Staphylococcus aureus (strain NCTC 8325)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLKWVAYFLKSRMNWIFWILFLNFLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLLL TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDIKWCRMIIRQILSNALK YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SS18 siRNA (Human)
CRH4623-01 15 nmol

SS18 siRNA (Human)

Sign In for Pricing
View Details
SS18 siRNA (Human)
CRH4623-02 30 nmol

SS18 siRNA (Human)

Sign In for Pricing
View Details
IKK gamma (IKBKG) Mouse Monoclonal Antibody [Clone ID: OTI3C3]
TA812459 100 µL

IKK gamma (IKBKG) Mouse Monoclonal Antibody [Clone ID: OTI3C3]

Sign In for Pricing
View Details
Rcan2 (NM_175578) Rat Tagged Lenti ORF Clone
RR207596L3 10 µg

Rcan2 (NM_175578) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRAF1 Antibody
MBS7124403-01 0.05 mL

TRAF1 Antibody

Sign In for Pricing
View Details
TRAF1 Antibody
MBS7124403-02 0.1 mL

TRAF1 Antibody

Sign In for Pricing
View Details