Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS)

This Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Sensor histidine kinase graS, EC= 2.7.13.3, Glycopeptide resistance-associated protein S

UniProt

Q2YSS1

Expression Region

1-346

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLIL TYFKEVKLYKHFDKDKEIEEIKHKDFAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDIKWCRMIIRQILSNALK YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM176A (NM_018487) Human Recombinant Protein
TP303433L 1 mg

TMEM176A (NM_018487) Human Recombinant Protein

Sign In for Pricing
View Details
Zfp11 Mouse Gene Knockout Kit (CRISPR)
KN519719 1 Kit

Zfp11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PRPK (TP53RK) activation kit by CRISPRa
GA114374 1 Kit

Human PRPK (TP53RK) activation kit by CRISPRa

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF640R conjugate, 0.1mg/mL
BNC401485-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Siglec 7 (SIGLEC7) (NM_014385) Human Over-expression Lysate
LY402325 100 µg

Siglec 7 (SIGLEC7) (NM_014385) Human Over-expression Lysate

Sign In for Pricing
View Details
OBP2A (NM_001293189) Human Tagged ORF Clone
RG236729 10 µg

OBP2A (NM_001293189) Human Tagged ORF Clone

Sign In for Pricing
View Details