Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1477 (MJ1477)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1477 (MJ1477) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1477

UniProt

Q58872

Expression Region

1-346

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLNKIRGKNMKKSHILGIIICIILIVGFFISFDSTFLDNPKMMSKSKNNIRNAENLTNI SKNSNNLKFLWAYQLQNADIDEIANSNFTLIVIDYSKDGTENGKYSEEEIEKLKKAGKIP IAYISIGEAEDYRFYWDNEWLKNPPKWLGDENPEWEGCYAVKYWHPEWKKIIFSYLDKII QQGFCGVYLDKVDEFEYWAENGYDEDFTAKEMIKFIVEISNYCRNKTNNSFIIIPQNGER LLEYDKHGKLLNTVSGWAVEDLFYDGVEQKTEEEINERIKLLDKVKDSGKFVLVVDYVDD GTKTNENLKRVEDFINKSLDKGYVPYVAKSDRELDELNTWWLKLIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100B (Astrocyte and Melanoma Marker), Biotin conjugate, 0.1mg/mL
BNCB1727-100 1x 100 µL

S100B (Astrocyte and Melanoma Marker), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp763 Mouse Gene Knockout Kit (CRISPR)
KN519969 1 Kit

Zfp763 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vimentin (VIM) Mouse Monoclonal Antibody [Clone ID: 4F2E9]
AM06304SU-N 100 µL

Vimentin (VIM) Mouse Monoclonal Antibody [Clone ID: 4F2E9]

Sign In for Pricing
View Details
Copper Aluminum Oxide (Technical Grade)
TRC-C990308-25G 25 g

Copper Aluminum Oxide (Technical Grade)

Sign In for Pricing
View Details
Tissue Protein Lysate, Liver
CP520428 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details
Recombinant Human HBAZ Protein (His Tag)
PKSH032531-01 10 µg

Recombinant Human HBAZ Protein (His Tag)

Sign In for Pricing
View Details