Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phytophthora infestans Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

This Recombinant Phytophthora infestans Mitochondrial import inner membrane translocase subunit TIM50 (TIM50) spans the amino acid sequence from region 64-409.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50, NIF domain protein 3

UniProt

Q5S7T7

Expression Region

64-409

Origin

Phytophthora infestans (Potato late blight fungus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ARKAAKHSADAATGHKVVRTSSLPARISFALLAGSISGSIVWNFVLDDGIKSRVKETLGA TFLGDIYAIIAKKVEETVKPFTDPSRQKLLPDWPIPQVPADTPTVPVLVLDLEDTLVHSE WSRKHGWRHAKRPGVDEFLETLCQYYEIVIFSQNYGAEEIVQKLDPKQCALHILSRDATR YLNGAHVKDLSNLNRDLRQVVILDDDPAAYQLQPENAIPVTPFTNGRDRDDHELKDLIPF LKALASERVPDFRQVIGEFRDEDGVVRDLATKYGARVHQLEMQKEQKKKKGFGGFVRGRL SHHPASPTGGVAASGFSSGPHVLKRWTLLDSSAYVVAPRCIKEKCM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL23 (Center) Rabbit Polyclonal Antibody
AP53712PU-N 400 µL

RPL23 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rnase4 (NM_201239) Mouse Tagged ORF Clone
MG201018 10 µg

Rnase4 (NM_201239) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Colorimeter BMET-804
BMET-804 1 Unit

Colorimeter BMET-804

Sign In for Pricing
View Details
SEL1L3 (NM_015187) Human Recombinant Protein
TP309318L 1 mg

SEL1L3 (NM_015187) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mitochondrial Fission 1 Protein Antibody
RC-15960-01 50 μL

Recombinant Mitochondrial Fission 1 Protein Antibody

Sign In for Pricing
View Details
Recombinant Mitochondrial Fission 1 Protein Antibody
RC-15960-02 100 µL

Recombinant Mitochondrial Fission 1 Protein Antibody

Sign In for Pricing
View Details