Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS)

This Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Sensor histidine kinase graS, EC= 2.7.13.3, Glycopeptide resistance-associated protein S

UniProt

Q6GBH0

Expression Region

1-346

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLIL TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDIKWCRMIIRQILSNALK YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF2 polyclonal antibody
BS72078-01 50 µL

ZNF2 polyclonal antibody

Sign In for Pricing
View Details
ZNF2 polyclonal antibody
BS72078-02 100 µL

ZNF2 polyclonal antibody

Sign In for Pricing
View Details
Syndecan-4 (K175) polyclonal antibody
BS2994-01 50 µL

Syndecan-4 (K175) polyclonal antibody

Sign In for Pricing
View Details
Syndecan-4 (K175) polyclonal antibody
BS2994-02 100 µL

Syndecan-4 (K175) polyclonal antibody

Sign In for Pricing
View Details
Potassium Hydroxide Solution 0.5M (0.5N)
VM2000-F 2.5 L

Potassium Hydroxide Solution 0.5M (0.5N)

Sign In for Pricing
View Details
MCL1 Blocking Peptide
MBS9614695-01 1 mg

MCL1 Blocking Peptide

Sign In for Pricing
View Details