Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS)

This Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Sensor histidine kinase graS, EC= 2.7.13.3, Glycopeptide resistance-associated protein S

UniProt

Q6GJ10

Expression Region

1-346

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLKWVVYFLKSRKNWIFWILFLNILMLGISLIDYDFPIDSLFYIVSLNLSLTLIFLIL TFFKEVKLYRHFEKDKEIEEIKHKDLAETPFQRHTVDYLYRQILAHKDKVVDQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEENQERKQALLFEWSRINSMLDTQLYITRLESQRKD MFFDYVSLKRMVIDEIQLTRHISQVKGIGFDIDFKVDNHVYTDIKWCRMIIRQILSNALK YSENYNVDISTELIDQHVALIIKDHGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VDSVKDQLGIQLQVTSTIGKGTTVKLIFPLQNEIVERMSEVTNLSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP5 Recombinant Protein (Human)
RP028018 100 µg

SENP5 Recombinant Protein (Human)

Sign In for Pricing
View Details
XCL1 (Lymphotactin, ATAC, C Motif Chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible Cytokine C1, XC Chemokine Ligand 1, LTN, SCYC1) (MaxLight 550)
MBS6214797-01 0.1 mL

XCL1 (Lymphotactin, ATAC, C Motif Chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible Cytokine C1, XC Chemokine Ligand 1, LTN, SCYC1) (MaxLight 550)

Sign In for Pricing
View Details
XCL1 (Lymphotactin, ATAC, C Motif Chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible Cytokine C1, XC Chemokine Ligand 1, LTN, SCYC1) (MaxLight 550)
MBS6214797-02 5x 0.1 mL

XCL1 (Lymphotactin, ATAC, C Motif Chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible Cytokine C1, XC Chemokine Ligand 1, LTN, SCYC1) (MaxLight 550)

Sign In for Pricing
View Details
CALCRL Antibody Blocking Peptide
orb1506874 500 µg

CALCRL Antibody Blocking Peptide

Sign In for Pricing
View Details
DPEP2 Protein Vector (Human) (pPM-C-HA)
PV012979 500 ng

DPEP2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Colon adenocarcinoma TMA, 5 samples have matched cancer adjacent tissue samples, including pathology grade, TNM and clinical stage (reference AJCC 8th version) with MMR (MLH1/PMS2/MSH2/MSH6 2017 Ventana MMR kit) IHC results,52 cases/ 57 cores(core size 1.5mm)
CO571 1 Each

Colon adenocarcinoma TMA, 5 samples have matched cancer adjacent tissue samples, including pathology grade, TNM and clinical stage (reference AJCC 8th version) with MMR (MLH1/PMS2/MSH2/MSH6 2017 Ventana MMR kit) IHC results,52 cases/ 57 cores(core size 1.5mm)

Sign In for Pricing
View Details