Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS)

This Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Sensor histidine kinase graS, EC= 2.7.13.3, Glycopeptide resistance-associated protein S

UniProt

Q8NXR5

Expression Region

1-346

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLIL TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDIKWCRMIIRQILSNALK YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIRF (UHRF2) Rabbit Polyclonal Antibody
TA371442 100 µL

NIRF (UHRF2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA5B Rabbit Polyclonal Antibody
TA372155 100 µL

CA5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Commd3 (NM_147778) Mouse Tagged ORF Clone
MG201917 10 µg

Commd3 (NM_147778) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Gastrin (GAST/2633), CF740 conjugate, 0.1mg/mL
BNC742633-100 1x 100 µL

Gastrin (GAST/2633), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fatty Acid Binding Protein 5 (FABP5) Rabbit Polyclonal Antibody
TA376072 100 µL

Fatty Acid Binding Protein 5 (FABP5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), 0.2mg/mL
BNUB1786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), 0.2mg/mL

Sign In for Pricing
View Details