Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS)

This Recombinant Staphylococcus aureus Sensor histidine kinase graS (graS) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Sensor histidine kinase graS, EC= 2.7.13.3, Glycopeptide resistance-associated protein S

UniProt

Q8NXR5

Expression Region

1-346

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFYIVSLNLSLTMIFLIL TYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQISAHKEKVVEQQLQLNMH EQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINSMLDTQLYITRLESQRKD MYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYTDIKWCRMIIRQILSNALK YSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERGFTSTANRNETTSSGMGLYL VNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSEVTNLSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM47 Antibody
KC-20958-01 50 μL

TRIM47 Antibody

Sign In for Pricing
View Details
TRIM47 Antibody
KC-20958-02 100 µL

TRIM47 Antibody

Sign In for Pricing
View Details
TRIM47 Antibody
KC-20958-03 1 mL

TRIM47 Antibody

Sign In for Pricing
View Details
Atoh1 Mouse Gene Knockout Kit (CRISPR)
KN501752 1 Kit

Atoh1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF594 conjugate, 0.1mg/mL
BNC942226-100 1x 100 µL

FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RNF11 activation kit by CRISPRa
GA108956 1 Kit

Human RNF11 activation kit by CRISPRa

Sign In for Pricing
View Details