Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lipase chaperone (lifO)

This Recombinant Lipase chaperone (lifO) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Lipase chaperone, Lipase activator protein, Lipase foldase, Lipase helper protein, Lipase modulator

UniProt

Q9X2S4

Expression Region

1-346

Origin

Acinetobacter lwoffii

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGKFINHKTIVFGVITSVLLLLLLIYYVFKPEAQTQNQNINTQTIQPENTVLESATANN KQGKLPTLAASLQGTEIDCPIQVDANGKLILTVGIRSCFDYFFSSLGEKTEAELVADIRQ YLLATLPESASNYAIYLLDQYVAYMHALQNLKPNAGFKSNNVDALQKVVDQMAKVQQQFF NAAEINALFGNERNLNQFNLEQMRIHANKNLTTQEKATELAKLIDELPPALADGVRVSMQ FAELQQLTKEIQAKGGSAQDLRSMRESLLGPEAADRLEKVDQEEAVWQTQVNQYLSARDQ ILKSDANDASKQQSIAELRNSSFGTKEDLLRAQSYEVMHDQKSKGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0460 antibody - middle region (ARP55196_P050)
ARP55196_P050 100 µL

KIAA0460 antibody - middle region (ARP55196_P050)

Sign In for Pricing
View Details
Mouse Tmem151a (NM_001001885) AAV Particle
MR207482A1V 250 µL

Mouse Tmem151a (NM_001001885) AAV Particle

Sign In for Pricing
View Details
Defb45 Protein Vector (Mouse) (pPM-C-HA)
PV171572 500 ng

Defb45 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Olr1162 3'UTR GFP Stable Cell Line
TU264507 1.0 mL

Olr1162 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-EGFR/ERBB1/HER1 (TAD011) Biosimilar (Monoclonal, IgG)
A136074 100 µL

Anti-EGFR/ERBB1/HER1 (TAD011) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
Togni’s Reagent
TRC-T529000-1G 1 g

Togni’s Reagent

Sign In for Pricing
View Details