Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lipase chaperone (lifO)

This Recombinant Lipase chaperone (lifO) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Lipase chaperone, Lipase activator protein, Lipase foldase, Lipase helper protein, Lipase modulator

UniProt

Q9X2S4

Expression Region

1-346

Origin

Acinetobacter lwoffii

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGKFINHKTIVFGVITSVLLLLLLIYYVFKPEAQTQNQNINTQTIQPENTVLESATANN KQGKLPTLAASLQGTEIDCPIQVDANGKLILTVGIRSCFDYFFSSLGEKTEAELVADIRQ YLLATLPESASNYAIYLLDQYVAYMHALQNLKPNAGFKSNNVDALQKVVDQMAKVQQQFF NAAEINALFGNERNLNQFNLEQMRIHANKNLTTQEKATELAKLIDELPPALADGVRVSMQ FAELQQLTKEIQAKGGSAQDLRSMRESLLGPEAADRLEKVDQEEAVWQTQVNQYLSARDQ ILKSDANDASKQQSIAELRNSSFGTKEDLLRAQSYEVMHDQKSKGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant C5 Protein (Gln 24-Ala 1688) [His]
VAng-1147Lsx-1mg 1 mg

Recombinant C5 Protein (Gln 24-Ala 1688) [His]

Sign In for Pricing
View Details
PKC ζ (H-1) : m-IgGκ BP-HRP Bundle
sc-520653 1 Kit

PKC ζ (H-1) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
2'-[ (tert-Butoxy) carbonyl]-2',3'-dihydro-1'H-spiro[cyclopropane-1,4'-isoquinoline]-1'-carboxylic acid
WLD79997-01 50 mg

2'-[ (tert-Butoxy) carbonyl]-2',3'-dihydro-1'H-spiro[cyclopropane-1,4'-isoquinoline]-1'-carboxylic acid

Sign In for Pricing
View Details
2'-[ (tert-Butoxy) carbonyl]-2',3'-dihydro-1'H-spiro[cyclopropane-1,4'-isoquinoline]-1'-carboxylic acid
WLD79997-02 0.5 g

2'-[ (tert-Butoxy) carbonyl]-2',3'-dihydro-1'H-spiro[cyclopropane-1,4'-isoquinoline]-1'-carboxylic acid

Sign In for Pricing
View Details
CBFβ Inhibitor
sc-221405 10 mg

CBFβ Inhibitor

Sign In for Pricing
View Details
Recombinant Goat Kit ligand (KITLG), partial
MBS1381870-01 0.5 mg (E-Coli)

Recombinant Goat Kit ligand (KITLG), partial

Sign In for Pricing
View Details