Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proline-rich transmembrane protein 2 (Prrt2)

This Recombinant Mouse Proline-rich transmembrane protein 2 (Prrt2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 2

UniProt

E9PUL5

Expression Region

1-346

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASSSQVSEMKGVEDSSKTQTEGPRHSEEGLGPVQVVAEIPDQPEALQPGPGITAAPVD SGPKAELAPETTETPVETPETVQATDLSLNPEEGSKASPSPSPSEARQEPASKPDVNRET AAEEGSEPQSTAPPEPTSEPAFQINTQSDPQPTSQPPPKPPLQAEPPTQEDPTTEVLTES TGEKQENGAVVPLQAGDGEEGPAPQPHSPPSTKTPPANGAPPRVLQKLVEEDRIGRAHGG HPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMS RNSLQQGDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFIT2 Human shRNA Lentiviral Particle (Locus ID 3433)
TL312245V 500 µL Each

IFIT2 Human shRNA Lentiviral Particle (Locus ID 3433)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
MBS2043887-01 0.1 mL

PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
MBS2043887-02 0.2 mL

PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
MBS2043887-03 0.5 mL

PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
MBS2043887-04 1 mL

PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)
MBS2043887-05 5 mL

PE-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing
View Details