Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proline-rich transmembrane protein 2 (Prrt2)

This Recombinant Mouse Proline-rich transmembrane protein 2 (Prrt2) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 2

UniProt

E9PUL5

Expression Region

1-346

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASSSQVSEMKGVEDSSKTQTEGPRHSEEGLGPVQVVAEIPDQPEALQPGPGITAAPVD SGPKAELAPETTETPVETPETVQATDLSLNPEEGSKASPSPSPSEARQEPASKPDVNRET AAEEGSEPQSTAPPEPTSEPAFQINTQSDPQPTSQPPPKPPLQAEPPTQEDPTTEVLTES TGEKQENGAVVPLQAGDGEEGPAPQPHSPPSTKTPPANGAPPRVLQKLVEEDRIGRAHGG HPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMS RNSLQQGDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC5 antibody
70R-21558 50 μL

HDAC5 antibody

Sign In for Pricing
View Details
Calcitonin III (Salmon) - Biotin Labeled
B-014-17 100 µg

Calcitonin III (Salmon) - Biotin Labeled

Sign In for Pricing
View Details
DTD1/HARS2 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2514715 100 µL

DTD1/HARS2 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
PPM1G (Center) Rabbit pAb
E2616678 100 µL

PPM1G (Center) Rabbit pAb

Sign In for Pricing
View Details
DDR2, Recombinant, Human, aa22-399, His-Tag (Discoidin Domain-containing Receptor 2)
369048 50 µg

DDR2, Recombinant, Human, aa22-399, His-Tag (Discoidin Domain-containing Receptor 2)

Sign In for Pricing
View Details
NDOR1 CRISPR Activation Plasmid (h2)
sc-411974-ACT-2 20 µg

NDOR1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details