Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0283 membrane protein PC1_2326 (PC1_2326)

This Recombinant Pectobacterium carotovorum subsp. carotovorum UPF0283 membrane protein PC1_2326 (PC1_2326) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

UPF0283 membrane protein PC1_2326

UniProt

C6DJX5

Expression Region

1-347

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEPLKPRVTFDDASPQEPLPQLRAGLAFDEQSGTPFSPISREEEVPEEGAAEEAISAAL RPKRSLWRRMVMAGIGLFGVSALAQGVQSLHNAWIQQDWIALGGITAGSLIVAAGVGSLV VEWRRLYRLRERAEERDVARDLLHSHGVGRGREFCEKLARQAGLDSGHPAIQRWQASLHE THNDREVLELYARLVQPVLDTQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIAALYGIELGYFSRIRLFRLVLINIAFAGASELVREIGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWLDDKPRLGDFRRELIGQVKETLQKGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-500 1x 500 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF405S conjugate, 0.1mg/mL
BNC042136-500 1x 500 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details