Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q2FI17

Expression Region

20-366

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKRD62 activation kit by CRISPRa
GA117543 1 Kit

Human ANKRD62 activation kit by CRISPRa

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (IGA/1790R), CF647 conjugate, 0.1mg/mL
BNC471790-100 1x 100 µL

CD79a (B-Cell Marker) (IGA/1790R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arhgap9 Mouse Gene Knockout Kit (CRISPR)
KN501518 1 Kit

Arhgap9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NG2 (CSPG4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H8]
TA812897AM 100 µL

NG2 (CSPG4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H8]

Sign In for Pricing
View Details
Granzyme B (GZMB) (NM_004131) Human Over-expression Lysate
LC401332 20 µg

Granzyme B (GZMB) (NM_004131) Human Over-expression Lysate

Sign In for Pricing
View Details
Prss2 Mouse Gene Knockout Kit (CRISPR)
KN514024 1 Kit

Prss2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details