Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q2FZJ9

Expression Region

20-366

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC4 (Trafficking Protein Particle Complex Subunit 4, Synbindin, TRS23 Homolog, Hematopoietic Stem/Progenitor Cell Protein 172, SBDN, CGI-104, HSPC172, PTD009) (MaxLight 650)
134694-ML650 100 µL

TRAPPC4 (Trafficking Protein Particle Complex Subunit 4, Synbindin, TRS23 Homolog, Hematopoietic Stem/Progenitor Cell Protein 172, SBDN, CGI-104, HSPC172, PTD009) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Monoclonal CCR6 Antibody (1011306) [HRP]
FAB1951H 0.1 mL

Mouse Monoclonal CCR6 Antibody (1011306) [HRP]

Sign In for Pricing
View Details
BDNF Protein Vector (Mouse) (pPB-C-His)
PV159226 500 ng

BDNF Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
VSTM2A, ID (VSTM2A, VSTM2, V-set and transmembrane domain-containing protein 2A) (Azide free) (HRP) discontinued
043787-HRP 200 µL

VSTM2A, ID (VSTM2A, VSTM2, V-set and transmembrane domain-containing protein 2A) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Pyrococcus woesei Glutamine synthetase 1 (glnA)
MBS1071851-01 0.02 mg (E-Coli)

Recombinant Pyrococcus woesei Glutamine synthetase 1 (glnA)

Sign In for Pricing
View Details
Recombinant Pyrococcus woesei Glutamine synthetase 1 (glnA)
MBS1071851-02 0.02 mg (Yeast)

Recombinant Pyrococcus woesei Glutamine synthetase 1 (glnA)

Sign In for Pricing
View Details