Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q2FZJ9

Expression Region

20-366

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Siglec-3/CD33 Antibody (996816) [DyLight 405]
FAB11372E 0.1 mL

Mouse Monoclonal Siglec-3/CD33 Antibody (996816) [DyLight 405]

Sign In for Pricing
View Details
Mouse Dipeptidyl Peptidase 8 (DPP8) ELISA Kit
abx153927-01 96 Tests

Mouse Dipeptidyl Peptidase 8 (DPP8) ELISA Kit

Sign In for Pricing
View Details
Mouse Dipeptidyl Peptidase 8 (DPP8) ELISA Kit
abx153927-02 5x 96 Tests

Mouse Dipeptidyl Peptidase 8 (DPP8) ELISA Kit

Sign In for Pricing
View Details
Mouse Dipeptidyl Peptidase 8 (DPP8) ELISA Kit
abx153927-03 10x 96 Tests

Mouse Dipeptidyl Peptidase 8 (DPP8) ELISA Kit

Sign In for Pricing
View Details
PINK1 (PTEN) Polyclonal Antibody
ABP-PAB-24515 100 ug

PINK1 (PTEN) Polyclonal Antibody

Sign In for Pricing
View Details
ILF3 Rabbit Monoclonal Antibody [Clone ID: R04-9E8]
TA384530 100 µL

ILF3 Rabbit Monoclonal Antibody [Clone ID: R04-9E8]

Sign In for Pricing
View Details