Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q2YX14

Expression Region

20-366

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSEKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]
E-AB-F097830-01 100 µg

AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]
E-AB-F097830-02 1 mg

AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]
E-AB-F097830-03 5 mg

AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]
E-AB-F097830-04 25 mg

AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]
E-AB-F097830-05 50 mg

AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]
E-AB-F097830-06 100 mg

AF/LE Purified Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details