Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q6GAF2

Expression Region

20-366

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF640R conjugate, 0.1mg/mL
BNC403048-100 1x 100 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl Carbazate
TRC-E900950-5G 5 g

Ethyl Carbazate

Sign In for Pricing
View Details
VivoBriteTM Rapid Antibody Labeling Kit for Small Animal In Vivo Imaging, CF®770 SE
#92162 1 Kit

VivoBriteTM Rapid Antibody Labeling Kit for Small Animal In Vivo Imaging, CF®770 SE

Sign In for Pricing
View Details
Helicobacter pylori (HP/1335), CF568 conjugate, 0.1mg/mL
BNC681335-100 1x 100 µL

Helicobacter pylori (HP/1335), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAPPC3L Antibody
KC-31268-01 50 μL

TRAPPC3L Antibody

Sign In for Pricing
View Details
TRAPPC3L Antibody
KC-31268-02 100 µL

TRAPPC3L Antibody

Sign In for Pricing
View Details