Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q6GI23

Expression Region

20-366

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAA4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV648230 1.0 µg DNA

SAA4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
General Phosphatidylinositol 4,5-bisphosphate, PIP2 ELISA KIT
EA0051Ge-01 96 Well

General Phosphatidylinositol 4,5-bisphosphate, PIP2 ELISA KIT

Sign In for Pricing
View Details
Mid-Range DNA Marker: 0.5 – 5 kb
12447-2 100 mcg

Mid-Range DNA Marker: 0.5 – 5 kb

Sign In for Pricing
View Details
Anti-Interleukin-10 IL10 Antibody Picoband® (Dylight488 Conjugate)
RP1014-Dylight488 100 µg

Anti-Interleukin-10 IL10 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
H mgB4
E8ER1910-66 100 µL

H mgB4

Sign In for Pricing
View Details
MBD2 Human shRNA Plasmid Kit (Locus ID 8932)
TR303331 1 Kit

MBD2 Human shRNA Plasmid Kit (Locus ID 8932)

Sign In for Pricing
View Details