Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q6GI23

Expression Region

20-366

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYGB protein
30R-3154 0.1 mg

PYGB protein

Sign In for Pricing
View Details
Phospho-PKC delta (Ser299) Rabbit mAb
E2R26337 100 µL

Phospho-PKC delta (Ser299) Rabbit mAb

Sign In for Pricing
View Details
FMO2 Rabbit pAb
E47R16153 100 µL

FMO2 Rabbit pAb

Sign In for Pricing
View Details
PUS7 CRISPR Activation Plasmid (m2)
sc-429696-ACT-2 20 µg

PUS7 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Human LCN12 Protein, N-GST
YHJ06001 100 μg

Recombinant Human LCN12 Protein, N-GST

Sign In for Pricing
View Details
Smn1 Polyclonal Antibody
CAC07911-01 50 µg

Smn1 Polyclonal Antibody

Sign In for Pricing
View Details