Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor protein vraS (vraS)

This Recombinant Staphylococcus aureus Sensor protein vraS (vraS) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Sensor protein vraS, EC= 2.7.13.3

UniProt

Q7A2Q0

Expression Region

1-347

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHYNRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)
MBS2082153-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)
MBS2082153-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)
MBS2082153-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)
MBS2082153-04 1 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)
MBS2082153-05 5 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)
MBS2082153-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Non Metastatic Cells 3, Protein NM23A Expressed In (NME3)

Sign In for Pricing
View Details