Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sensor protein vraS (vraS)

This Recombinant Staphylococcus aureus Sensor protein vraS (vraS) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Sensor protein vraS, EC= 2.7.13.3

UniProt

Q7A0H9

Expression Region

1-347

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLC IIVGSVLAYKINQQNDWIKTQIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHK LRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKETKLEP PLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEK LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEDSYDD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r157 (NM_001166754) Mouse Untagged Clone
MC215411 10 µg

Vmn1r157 (NM_001166754) Mouse Untagged Clone

Sign In for Pricing
View Details
Aminopeptidase N (rat)
HY-E70199 1 Each

Aminopeptidase N (rat)

Sign In for Pricing
View Details
PLEKHH3 Human shRNA Plasmid Kit (Locus ID 79990)
TR302422 1 Kit

PLEKHH3 Human shRNA Plasmid Kit (Locus ID 79990)

Sign In for Pricing
View Details
Anti-GUCY1A1 antibody R2G - 1mg/mL
CRB2005736_2 20 µg

Anti-GUCY1A1 antibody R2G - 1mg/mL

Sign In for Pricing
View Details
Beta Tubulin Mouse mAb (FITC)
orb2710950-01 100 µL

Beta Tubulin Mouse mAb (FITC)

Sign In for Pricing
View Details
Beta Tubulin Mouse mAb (FITC)
orb2710950-02 1 mL

Beta Tubulin Mouse mAb (FITC)

Sign In for Pricing
View Details