Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q7A181

Expression Region

20-366

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigment Red 23 (tech grade)
TRC-P437790-500MG 500 mg

Pigment Red 23 (tech grade)

Sign In for Pricing
View Details
Human BRUNOL5 (CELF5) activation kit by CRISPRa
GA111883 1 Kit

Human BRUNOL5 (CELF5) activation kit by CRISPRa

Sign In for Pricing
View Details
Dual Purpose Incubator BIDP-103
BIDP-103 1 Unit

Dual Purpose Incubator BIDP-103

Sign In for Pricing
View Details
Recombinant Porcine COL2A1 Protein (His Tag)
PDMP100003-01 20 µg

Recombinant Porcine COL2A1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Porcine COL2A1 Protein (His Tag)
PDMP100003-02 100 µg

Recombinant Porcine COL2A1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Porcine COL2A1 Protein (His Tag)
PDMP100003-03 500 µg

Recombinant Porcine COL2A1 Protein (His Tag)

Sign In for Pricing
View Details