Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA)

This Recombinant Staphylococcus aureus Probable quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 20-366.

Product Specifications

Product Name Alternative

Probable quinol oxidase subunit 2, EC= 1.10.3.-, Quinol oxidase polypeptide II

UniProt

Q7A698

Expression Region

20-366

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHN AIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHI ETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRN SNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTH MAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRH GMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GHRH (Growth Hormone Releasing Hormone) ELISA Kit
EH21072 96 Tests

Human GHRH (Growth Hormone Releasing Hormone) ELISA Kit

Sign In for Pricing
View Details
TM4SF18 (NM_138786) Human Over-expression Lysate
LH13856V 100 µg

TM4SF18 (NM_138786) Human Over-expression Lysate

Sign In for Pricing
View Details
NBN Rabbit pAb, PE-Cy5 conjugated
orb2853165 100 µL

NBN Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
FLYWCH1 antibody - middle region (ARP60443_P050)
ARP60443_P050 100 µL

FLYWCH1 antibody - middle region (ARP60443_P050)

Sign In for Pricing
View Details
PDP2 Recombinant Protein Antigen
NBP2-57082PEP 100 µL

PDP2 Recombinant Protein Antigen

Sign In for Pricing
View Details
ZNF24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
51379061 1.0 µg DNA

ZNF24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details