Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apocytochrome f, chloroplastic (petA)

This Recombinant Apocytochrome f, chloroplastic (petA) spans the amino acid sequence from region 150-496.

Product Specifications

Product Name Alternative

Apocytochrome f, chloroplastic

UniProt

Q8GZR2

Expression Region

150-496

Origin

Euglena gracilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPIFAQQAYGNPREATGRIVCANCHLASKPTEIEVPQAVLPDQVFEAVTKVPFSGPSGFF NVVDPSTVVGSVTFAGTQPVGFIQESGVPVSQALVDIATPGTPDTVFKATIKVPYDESLK QVAGNGRAAPLNVGAVLILPEGFRLAPPERIPEKMKEEINGLQFIQYSKDTPNILVVGPV PGKKYAEMTVALLSPDPRVDKKAEFGTLPIYVGGNRGRGQLYPTGEKSNNNIYNVEHSGK IADIQLNEKKRIYTVAVQQKDGEIINEDLPAGAELIVKVGDVVEAGQAISTNPNVGGFGQ AESEIVLQNPGRVQAFLFFSFTVLATQTLLVVKKKQYEQVQLSEMNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-500 1x 500 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-100 1x 100 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details