Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0489c (Mb0489c)

This Recombinant Uncharacterized protein Mb0489c (Mb0489c) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0489c

UniProt

P64700

Expression Region

1-348

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNPQGPPNDPSPWARPGDQGPLARPPASSEASTGRLRPGEPAGHIQEPVSPPTQPEQQP QTEHLAASHAHTRRSGRQAAHQAWDPTGLLAAQEEEPAAVKTKRRARRDPLTVFLVLIIV FSLVLAGLIGGELYARHVANSKVAQAVACVVKDQATASFGVAPLLLWQVATRHFTNISVE TAGNQIRDAKGMQIKLTIQNVRLKNTPNSRGTIGALDATITWSSEGIKESVQNAIPILGA FVTSSVVTHPADGTVELKGLLNNITAKPIVAGKGLELQIINFNTLGFSLPKETVQSTLNE FTSSLTKNYPLGIHADSVQVTSTGVVSRFSTRDAAIPTGIQNPCFSHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig IGF-2 ELISA Kit
orb561577-01 48 Tests

Guinea pig IGF-2 ELISA Kit

Sign In for Pricing
View Details
Guinea pig IGF-2 ELISA Kit
orb561577-02 96 Tests

Guinea pig IGF-2 ELISA Kit

Sign In for Pricing
View Details
PSME1 Antibody
orb39375-01 50 μL

PSME1 Antibody

Sign In for Pricing
View Details
PSME1 Antibody
orb39375-02 100 µL

PSME1 Antibody

Sign In for Pricing
View Details
Human UDP-glucuronosyltransferase 3A2, UGT3A2 ELISA Kit
MBS9336154-01 48 Well

Human UDP-glucuronosyltransferase 3A2, UGT3A2 ELISA Kit

Sign In for Pricing
View Details
Human UDP-glucuronosyltransferase 3A2, UGT3A2 ELISA Kit
MBS9336154-02 96 Well

Human UDP-glucuronosyltransferase 3A2, UGT3A2 ELISA Kit

Sign In for Pricing
View Details