Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila grimshawi Serine protease HTRA2, mitochondrial (HtrA2)

This Recombinant Drosophila grimshawi Serine protease HTRA2, mitochondrial (HtrA2) spans the amino acid sequence from region 79-426.

Product Specifications

Product Name Alternative

Serine protease HTRA2, mitochondrial, EC= 3.4.21.108, High temperature requirement protein A2

UniProt

B4JTT7

Expression Region

79-426

Origin

Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALASSVVAGDRELMPTISAKTLTNNRRDFNFIADVVASCADSVVYIEIKDTRHFDYFSGQ PITASNGSGFVIEQNGLILTNAHVVINKPNTMVQVRLSDGRTFPATIEDVDQTSDLATLR IQVTNLSVMKLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINY LQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKLFLERAAARRKKGSA YKTGYPVKRYMGITMLTLTPDILFELKSRTQNMPETLSHGVLVWKVIVGSPAHSGGLQPG DIVTHINKKEIKNSSDVYDALADGKKDLDMVILRGVKQMRVTITPEDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-500 1x 500 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF740 conjugate, 0.1mg/mL
BNC740417-500 1x 500 µL

Fascin-1 (FSCN1/417), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCF4 (Transcription Factor 4) (TCF4/1705), CF640R conjugate, 0.1mg/mL
BNC401705-100 1x 100 µL

TCF4 (Transcription Factor 4) (TCF4/1705), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details