Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2)

This Recombinant Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2) spans the amino acid sequence from region 75-422.

Product Specifications

Product Name Alternative

Serine protease HTRA2, mitochondrial, EC= 3.4.21.108, High temperature requirement protein A2

UniProt

B3P3J9

Expression Region

75-422

Origin

Drosophila erecta (Fruit fly)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVVSAAVIKREDFTPTIAASKMTGRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQ PITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLR IQVNNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINY LQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKKGSA YKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPG DIVTHINKKEIKNSSDVYDALADNSKNLDIVILRGVKQMHVTITPEDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAGLN2 Rabbit Polyclonal Antibody
TA360986 100 µL

TAGLN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF568 conjugate, 0.1mg/mL
BNC680901-100 1x 100 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2819R), Biotin conjugate, 0.1mg/mL
BNCB2819-500 1x 500 µL

Cytokeratin 18 (KRT18) (KRT18/2819R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SAPK3 (MAPK12) (C-term) Rabbit Polyclonal Antibody
AP14130PU-N 400 µL

SAPK3 (MAPK12) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CARD9 Mouse Monoclonal Antibody [Clone ID: OTI3F8]
CF811909 100 µg

CARD9 Mouse Monoclonal Antibody [Clone ID: OTI3F8]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Swine IgG,  15nm
GAF-471-15 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Swine IgG, 15nm

Sign In for Pricing
View Details