Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2)

This Recombinant Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2) spans the amino acid sequence from region 75-422.

Product Specifications

Product Name Alternative

Serine protease HTRA2, mitochondrial, EC= 3.4.21.108, High temperature requirement protein A2

UniProt

B3P3J9

Expression Region

75-422

Origin

Drosophila erecta (Fruit fly)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVVSAAVIKREDFTPTIAASKMTGRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQ PITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLR IQVNNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINY LQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKKGSA YKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPG DIVTHINKKEIKNSSDVYDALADNSKNLDIVILRGVKQMHVTITPEDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Silica Gel, 35-70 Micron Particles
TRC-S450400-5KG 5 kg

Silica Gel, 35-70 Micron Particles

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB602549 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
Rat Kallikrein 3 (KLK3) ELISA Kit
RDR-KLK3-Ra-01 96 Tests

Rat Kallikrein 3 (KLK3) ELISA Kit

Sign In for Pricing
View Details
Rat Kallikrein 3 (KLK3) ELISA Kit
RDR-KLK3-Ra-02 48 Tests

Rat Kallikrein 3 (KLK3) ELISA Kit

Sign In for Pricing
View Details
GPBB (PYGB) (NM_002862) Human Over-expression Lysate
LY419055 100 µg

GPBB (PYGB) (NM_002862) Human Over-expression Lysate

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), Biotin conjugate, 0.1mg/mL
BNCB1408-100 1x 100 µL

Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details