Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chaetomium globosum NADH-cytochrome b5 reductase 2 (MCR1)

This Recombinant Chaetomium globosum NADH-cytochrome b5 reductase 2 (MCR1) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

NADH-cytochrome b5 reductase 2, EC= 1.6.2.2, Mitochondrial cytochrome b reductase

UniProt

Q2HG02

Expression Region

1-348

Origin

Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFVASRSAFRAAAPLKRQFQIRRYATEPPSADAKKGNNTLLYGAAAAAVAGAGYYFLG GTPAAKKAEEKVKDASSAAAGKLSTSEVKQALTGGEQGWVSLKLEEVEIVNHNSKRLRFR LPEDDMVSGVHVASAILTKFKPVDAEKPVIRPYTPTNDEDARGYLDLLVKKYPNGPMSTH LHDMVPGQRLDVKGPLPKYPWTANKHGHIALVAGGTGITPMFQLCRAIFNNPDDQTKVTL VFGNVREDDILLKKELAALENNNPRRFRAFYVLDDPPKHWTGGKGFITKDLLKTVLPEPK DENIKVFVCGPPGMMDAISGNKKSPKDQGELKGILKELGYSPEQVYKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-100 1x 100 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details