Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Sensor protein vraS (vraS)

This Recombinant Staphylococcus haemolyticus Sensor protein vraS (vraS) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Sensor protein vraS, EC= 2.7.13.3

UniProt

Q4L7J6

Expression Region

1-348

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHYLRAIGSMLILVYSMLTAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLVIILLC IIVGSILAYKINQQNQWIKSQIEHAIEGETVGINDQNIELYNETIDLYQTLVPLNQELHR LRMKTQNLTNENYNMNDVKVKKIIENERQRLARELHDSVSQQLFAASMMLSAIKETKLEA PLDQQIPVLEKMVQESQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVIHDI QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNQQDYLLLRIQDNGKGFNVDEK LEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNREDDNNDD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TRXR1/TXNRD1 Antibody, Rabbit Polyclonal
MBS8109308-01 0.1 mL

Anti-TRXR1/TXNRD1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-TRXR1/TXNRD1 Antibody, Rabbit Polyclonal
MBS8109308-02 5x 0.1 mL

Anti-TRXR1/TXNRD1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Ezrin / p81 (CPTC-Ezrin-1), CF488A conjugate, 0.1mg/mL
BNC882238-100 1x 100 µL

Ezrin / p81 (CPTC-Ezrin-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NOD1 (CARD4, Nucleotide-binding Oligomerization Domain-containing Protein 1, Caspase Recruitment Domain-containing Protein 4) APC
MBS6387217-01 0.1 mL

NOD1 (CARD4, Nucleotide-binding Oligomerization Domain-containing Protein 1, Caspase Recruitment Domain-containing Protein 4) APC

Sign In for Pricing
View Details
NOD1 (CARD4, Nucleotide-binding Oligomerization Domain-containing Protein 1, Caspase Recruitment Domain-containing Protein 4) APC
MBS6387217-02 5x 0.1 mL

NOD1 (CARD4, Nucleotide-binding Oligomerization Domain-containing Protein 1, Caspase Recruitment Domain-containing Protein 4) APC

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri gatB Protein (aa 1-476) (strain NBRC 12016)
VAng-Lsx9548-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri gatB Protein (aa 1-476) (strain NBRC 12016)

Sign In for Pricing
View Details