Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Sensor protein vraS (vraS)

This Recombinant Staphylococcus epidermidis Sensor protein vraS (vraS) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Sensor protein vraS, EC= 2.7.13.3

UniProt

Q5HN49

Expression Region

1-348

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHYIRAIGSMLILVYSMLIAFLFIDKVFVNIIFFQGMFYTQIFGIPVFLFLNLLIVLLC IIVGSVLAYKINQQNDWIISQIERSIEGQTVGINDQNIELYTETIDIYHTLVPLNQELHR LRMKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVSQQLFAASMMLSAIKESKLEP PLNQQIPILEKMVQDSQLEMRALLLHLRPIGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI QDFEVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNQEDYLLLRIQDNGKGFNVDEK FEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNKEENSSGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC39B Protein Vector (Rat) (pPM-C-HA)
PV313556 500 ng

TTC39B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CDH17/LI-cadherin Recombinant Antibody, Cy3 Conjugated
bsm-60434R-Cy3 100 µL

CDH17/LI-cadherin Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
RAP2B (1-183, His-tag) Human Protein
AR50790PU-N 500 µg

RAP2B (1-183, His-tag) Human Protein

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Leucine--tRNA ligase (leuS), partial
MBS1127987 Inquire

Recombinant Streptococcus pneumoniae Leucine--tRNA ligase (leuS), partial

Sign In for Pricing
View Details
MIR4539 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV733041 1.0 µg DNA

MIR4539 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Transcription factor 25 Rabbit Polyclonal Antibody (Cy5)
orb873539 100 µL

Transcription factor 25 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details