Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse SUN domain-containing protein 5 (Sun5)

This Recombinant Mouse SUN domain-containing protein 5 (Sun5) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

SUN domain-containing protein 5, Sperm-associated antigen 4-like protein

UniProt

Q9DA32

Expression Region

1-348

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRTRNIGALCTLPEDTTHSGRPRRGVQRSYISRMAEPAPANMTWLTYLACFLRTQTQQV FLNTCRCKLFCQKVMEKMGLLVLCVFGFWMFSMHLPSKVEVWQDDSINGPLQSLRMYQEK VRHHTGEIQDLRGSMNQLIAKLQKMEAISDEQKMAQKIMKMIQGDYIEKPDFALKSIGAS IDFEHTSATYNHDKARSYWNWIRLWNYAQPPDVILEPNVTPGNCWAFASDRGQVTIRLAQ KVYLSNITLQHIPKTISLSGSLDTAPKDFVIYGLESLPREEVFLGAFQFQPENIIQTFQL QNLPPRSFAAVKVKISSNWGNPRFTCMYRVRVHGSVTPPKDSHLEPLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Haier Biomedical Salvum Ultra Low Energy ULT Freezer -80C 829L
SLS1098 1 Each

Haier Biomedical Salvum Ultra Low Energy ULT Freezer -80C 829L

Sign In for Pricing
View Details
SNRNP48 AAV Vector (Rat) (CMV)
44964106 1 µg

SNRNP48 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
OR2S2 Antibody
MBS9604365-01 0.1 mL

OR2S2 Antibody

Sign In for Pricing
View Details
OR2S2 Antibody
MBS9604365-02 0.2 mL

OR2S2 Antibody

Sign In for Pricing
View Details
OR2S2 Antibody
MBS9604365-03 5x 0.2 mL

OR2S2 Antibody

Sign In for Pricing
View Details
Donkey anti-Rabbit IgG (H&L), DyLight® 405 conjugated
AS16 3509 1 mg

Donkey anti-Rabbit IgG (H&L), DyLight® 405 conjugated

Sign In for Pricing
View Details