Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse SUN domain-containing protein 5 (Sun5)

This Recombinant Mouse SUN domain-containing protein 5 (Sun5) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

SUN domain-containing protein 5, Sperm-associated antigen 4-like protein

UniProt

Q9DA32

Expression Region

1-348

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRTRNIGALCTLPEDTTHSGRPRRGVQRSYISRMAEPAPANMTWLTYLACFLRTQTQQV FLNTCRCKLFCQKVMEKMGLLVLCVFGFWMFSMHLPSKVEVWQDDSINGPLQSLRMYQEK VRHHTGEIQDLRGSMNQLIAKLQKMEAISDEQKMAQKIMKMIQGDYIEKPDFALKSIGAS IDFEHTSATYNHDKARSYWNWIRLWNYAQPPDVILEPNVTPGNCWAFASDRGQVTIRLAQ KVYLSNITLQHIPKTISLSGSLDTAPKDFVIYGLESLPREEVFLGAFQFQPENIIQTFQL QNLPPRSFAAVKVKISSNWGNPRFTCMYRVRVHGSVTPPKDSHLEPLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD24 Antibody (ML5) [HRP]
FAB5247H 0.1 mL

Mouse Monoclonal CD24 Antibody (ML5) [HRP]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli S-ribosylhomocysteine lyase polyclonal Antibody
MBS1491336-01 0.05 mg

Rabbit anti-Escherichia coli S-ribosylhomocysteine lyase polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli S-ribosylhomocysteine lyase polyclonal Antibody
MBS1491336-02 0.1 mg

Rabbit anti-Escherichia coli S-ribosylhomocysteine lyase polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli S-ribosylhomocysteine lyase polyclonal Antibody
MBS1491336-03 5x 0.1 mg

Rabbit anti-Escherichia coli S-ribosylhomocysteine lyase polyclonal Antibody

Sign In for Pricing
View Details
Slc5a2 3'UTR GFP Stable Cell Line
TU169179 1.0 mL

Slc5a2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Olfactory receptor 10A5 (OR10A5) ELISA Kit
GTR10358729 96 Well

Mouse Olfactory receptor 10A5 (OR10A5) ELISA Kit

Sign In for Pricing
View Details