Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized RING finger protein C57A7.09 (SPAC57A7.09)

This Recombinant Schizosaccharomyces pombe Uncharacterized RING finger protein C57A7.09 (SPAC57A7.09) spans the amino acid sequence from region 25-372.

Product Specifications

Product Name Alternative

Uncharacterized RING finger protein C57A7.09

UniProt

P87139

Expression Region

25-372

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LDLGVLDNIFIPKRFAASTDVAIQLPDRNVTLWSRQAVFGKHFTNASATTVINLYLPSNF QEDMSGCPNRNDTDASYFYENDIIDYDIEYIEQKSYSSKPSARVQKDDGGESKDEAILDF LLVQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSFRLHYMVAPDKVDESKVHIPSLFVS TSSYNLLWSDLLHSYRQPLKLYAKPEELGDMFWPFLLCFSPSIIMLITVQALAIRKFIRT YRTKSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECVIC LESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEVPPPKPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-500 1x 500 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-100 1x 100 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details