Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Mitochondrial inner membrane magnesium transporter LPE10 (LPE10)

This Recombinant Kluyveromyces lactis Mitochondrial inner membrane magnesium transporter LPE10 (LPE10) spans the amino acid sequence from region 49-397.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane magnesium transporter LPE10

UniProt

Q6CIB3

Expression Region

49-397

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSLYNPELETIRCTIFDRHGNMQKPSIDLRRDELIHTHGLLPRDLRKVEKSRRNDLVPSV LVRENSILVSILNIRALVKSDMLILFDSMGIKLDSVSQQNFIADLQLRLQNRSGFEVPDV VNKDPLPYEFRAVESIFISAISNLNAELKVHLNVSTGILQDLEYSITRDKLRYLLIQNKK LSVFHKKSFLMREMIEELLEQDDVLCEMYLTEKQLGKPREEHDHAEIEMLLETYYNHVDE IVQTVGNTMSNIKTTEEIINIILDSNRNQLMLLGLRFSIGLLSLAGSIFIASIYGMNLEN FIEEGNVGFPVVSTLGVILMAYLFAFSVKHLHKLEKVQLMSHGKSSTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-500 1x 500 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details