Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Putative protease sohB (sohB)

This Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Putative protease sohB (sohB) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Putative protease sohB, EC= 3.4.21.-

UniProt

Q89AL0

Expression Region

1-349

Origin

Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHFIYDCSLFLFKIVIVIFFIIFVSSIILKISRKKNKNFGILSVSSLNDHYELVKNSIIV QLMDKKTKKLWNKKNKMLKRSTLLTNNNKLIDKDHNIIVVRAQPTLYVIDFKGGIAAHEV KSLREEISSIISVAQKHDEVLLRLESSGGTIHGYGLAAVQLQRLRSRKIFLTISIDKIAT SGGYMMACVANYIIATPFSIIGSIGVVAQFPNIHKFLKKNNIDVELHTAGVHKRTLTIFG ENTPEDRKKFVEELNVAHDLFKKFVKTMRPSLNIEKLSNGECWFGSIALKKKLVDDINTS DDFIISRIRKFNILHVKFKYNESIIKALFYKKLKTINNLIYKYLNNKLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-500 1x 500 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-500 1x 500 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (BCL6/850), CF405S conjugate, 0.1mg/mL
BNC040850-500 1x 500 µL

Bcl-6 (BCL6/850), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (C-43), CF405S conjugate, 0.1mg/mL
BNC040688-100 1x 100 µL

Cytokeratin 8 (C-43), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details