Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila willistoni Serine protease HTRA2, mitochondrial (HtrA2)

This Recombinant Drosophila willistoni Serine protease HTRA2, mitochondrial (HtrA2) spans the amino acid sequence from region 85-434.

Product Specifications

Product Name Alternative

Serine protease HTRA2, mitochondrial, EC= 3.4.21.108, High temperature requirement protein A2

UniProt

B4N937

Expression Region

85-434

Origin

Drosophila willistoni (Fruit fly)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVASSLVMKRDDLELTPTISAARPSGRRREFNFIADVVGGCADSVVYIEIKDTRHFDYFS GQPITASNGSGFVIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLAT LRIQVNNLPVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDI NYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAERRKKG SAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLMHGVLVWKVIVGSPAHSGGLQ PGDIVTHINKKEIKNSSDVYDALGCGDKELNMIIMRGVKQMHVTITPEDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-100 1x 100 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF568 conjugate, 0.1mg/mL
BNC681784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details