Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis 3-ketoacyl-CoA reductase (UM04441)

This Recombinant Ustilago maydis 3-ketoacyl-CoA reductase (UM04441) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

3-ketoacyl-CoA reductase, 3-ketoreductase, KAR, EC= 1.1.1.-, Microsomal beta-keto-reductase

UniProt

Q4P622

Expression Region

1-350

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIEQHIDGLLRHVGLRVDHGLTPVSASLVLLAGIGALSVGTFALRLVRLFADVYILPGN SVSKYGANKKDLTRASWAVVTGATDGIGREFALQLARKGFNIVLVSRSPEKLGSVAAEIE AATPGVRTKTQAIDFALGDERQYEGLEHTVKGLNVGVLVNNVGKSHNMPVTFTETSEEEM EDIIEINVVSVLRVSKMIIPGMVDRKRGLVLNLGSFAGQVTTPMLATYAGSKAFLSGWSQ ALGEEVKRSNVDVSLLNTYFVVSNLSKIRKSSAMIPTPKQYVTQVLKTLGRNGGAVGRPY TATPWPGHALVDWATTFVLPRGWLLSYTYGQQVATRKRALNKAHKAVKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-100 1x 100 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF740 conjugate, 0.1mg/mL
BNC741035-500 1x 500 µL

CD8 (C8/1035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details