Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana ALA-interacting subunit 5 (ALIS5)

This Recombinant Arabidopsis thaliana ALA-interacting subunit 5 (ALIS5) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

ALA-interacting subunit 5, AtALIS5

UniProt

Q8L8W0

Expression Region

1-350

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTAASSTVGGGGSSEISGVKKTSKRPKYSRFTQQELPACKPILTPRWVILTFLVAGVV FIPLGVICLFASQGVVEIVDRYDTDCIPTSSRNNMVAYIQGEGDKICKRTITVTKAMKHP VYVYYQLENFYQNHRRYVKSRNDAQLRSPKEEHDVKTCAPEDNVGGEPIVPCGLVAWSLF NDTYSFSRNSQQLLVNKKGISWKSDRENKFGKNVFPKNFQKGAPIGGGTLNISKPLSEQE DLIVWMRTAALPTFRKLYGKIETDLHAGDTITVLLQNNYNTYSFNGQKKLVLSTTSWLGG RNDFLGIAYLTVGSICLFLAVTFAVLYLVKPRQLGDPSYLSWNRSAGGLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL
BNC681059-100 1x 100 µL

CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (HH1/957), CF594 conjugate, 0.1mg/mL
BNC940957-100 1x 100 µL

Histone H1 (HH1/957), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF488A conjugate, 0.1mg/mL
BNC881471-100 1x 100 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF640R conjugate, 0.1mg/mL
BNC401484-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details