Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lipase chaperone (lifO)

This Recombinant Lipase chaperone (lifO) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Lipase chaperone, Lipase activator protein, Lipase foldase, Lipase helper protein, Lipase modulator

UniProt

Q9PE46

Expression Region

1-350

Origin

Xylella fastidiosa

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKKYSFVNHRIVLYLILGCVVVCGVWYSFDVRQAIDVGAVDLSLPRMSNNLLKEVAVGE GKTTNRLSRLPVDSTVPTVLPQSLAGSIAPPLPLDAYGHLARVSAVRDFFDYFLTAQNDL TPAALDELVTHEIVKQLHGTSAQVEAQDVWTRYCAYFSQLVKLPDLGMVLGDKLDFVAVQ RALDQRASLAVRTLGDWSEPFFGAEQQRQRYDLERLKIADDQALTDEQKKKRLVALEQKL PSKVQEERIKIQQQQDAVVKIIQLQKDEVTPDGIRLQVVGLLGPEVAYRVAEMRRQDEIW QEKYKHYAAQRVQIEAQQLEPKEHDVQVENLRQRIFTKPGEALRAASLDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Immunoglobulin Alpha (IgA) Heavy Chain (rHISA43), CF640R conjugate, 0.1mg/mL
BNC403876-500 1x 500 µL

Human Immunoglobulin Alpha (IgA) Heavy Chain (rHISA43), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EPCAM (NM_002354) Human Over-expression Lysate
LY400847 100 µg

EPCAM (NM_002354) Human Over-expression Lysate

Sign In for Pricing
View Details
Midkine Recombinant Rabbit Monoclonal Antibody [JF096-5]
ET1702-64 100 µL

Midkine Recombinant Rabbit Monoclonal Antibody [JF096-5]

Sign In for Pricing
View Details
CTLA4 Human Gene Knockout Kit (CRISPR)
KN210150LP 1 Kit

CTLA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BEGAIN Mouse Monoclonal Antibody [Clone ID: OTI6E7]
CF810836 100 µg

BEGAIN Mouse Monoclonal Antibody [Clone ID: OTI6E7]

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR561496 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details