Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Simian virus 40 Minor capsid protein VP2

This Recombinant Simian virus 40 Minor capsid protein VP2 spans the amino acid sequence from region 2-352.

Product Specifications

Product Name Alternative

Minor capsid protein VP2, Minor structural protein VP2

UniProt

P03093

Expression Region

2-352

Origin

Simian virus 40 (SV40)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAALTLLGDLIATVSEAAAATGFSVAEIAAGEAAAAIEVQLASVATVEGLTTSEAIAAIG LIPQAYAVISGAPAAIAGFAALLQTVTGVSAVAQVGYRFFSDWDHKVSTVGLYQQPGMAV DLYRPDDYYDILFPGVQTFVHSVQYLDPRHWGPTLFNAISQAFWRVIQNDIPRLTSQELE RRTQRYLRDSLARFLEETTWTVINAPVNWYNSLQDYYSTLSPIRPTMVRQVANREGLQIS FGHTYDNIDEADSIQQVTERWEAQSQSPNVQSGEFIEKFEAPGGANQRTAPQWMLPLLLG LYGSVTSALKAYEDGPNKKKRKLSRGSSQKTKGTSASAKARHKRRNRSSRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-500 1x 500 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF640R conjugate, 0.1mg/mL
BNC400874-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details