Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS)

This Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Histidine protein kinase saeS, EC= 2.7.13.3, Sensor protein saeS, Staphylococcus exoprotein expression protein S

UniProt

Q2YSM6

Expression Region

1-351

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRTPLE RILTNLLDNALKFSNVGSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFRVE NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KI3X1 rabbit pAb
UB-GEN-7740 100 µL

KI3X1 rabbit pAb

Sign In for Pricing
View Details
TAX1BP3 Recombinant Antibody, Biotin Conjugated
bsm-61659R-Biotin-TR 20 µL

TAX1BP3 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
DFNA5 Polyclonal Antibody, Biotin Conjugated
bs-14286R-Biotin-01 20 µL

DFNA5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
DFNA5 Polyclonal Antibody, Biotin Conjugated
bs-14286R-Biotin-02 100 µL

DFNA5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Cypt3 AAV siRNA Pooled Vector
17541164 1.0 µg

Cypt3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
RPS8 (40S Ribosomal Protein S8, OK/SW-cl.83) (MaxLight 490)
132832-ML490 100 µL

RPS8 (40S Ribosomal Protein S8, OK/SW-cl.83) (MaxLight 490)

Sign In for Pricing
View Details