Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS)

This Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Histidine protein kinase saeS, EC= 2.7.13.3, Sensor protein saeS, Staphylococcus exoprotein expression protein S

UniProt

Q2YSM6

Expression Region

1-351

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRTPLE RILTNLLDNALKFSNVGSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFRVE NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP1A4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
12675124 3x 1.0µg DNA

ATP1A4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Anti-Spike RBD Antibody (Tixagevimab)
F1031-50 50 mg

Anti-Spike RBD Antibody (Tixagevimab)

Sign In for Pricing
View Details
5 L Single-Use Storage Bottle (G)
BIOBGBTA5L000 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

5 L Single-Use Storage Bottle (G)

Sign In for Pricing
View Details
ABCD4 Antibody
C14627-01 50 μL

ABCD4 Antibody

Sign In for Pricing
View Details
ABCD4 Antibody
C14627-02 100 µL

ABCD4 Antibody

Sign In for Pricing
View Details
Biotinylated Recombinant Human Alpha-1-acid glycoprotein 1/AGP1 (C-His)
BP096-25ug 25 µg

Biotinylated Recombinant Human Alpha-1-acid glycoprotein 1/AGP1 (C-His)

Sign In for Pricing
View Details