Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Simian virus 12 Minor capsid protein VP2

This Recombinant Simian virus 12 Minor capsid protein VP2 spans the amino acid sequence from region 2-352.

Product Specifications

Product Name Alternative

Minor capsid protein VP2, Minor structural protein VP2

UniProt

Q3L6L8

Expression Region

2-352

Origin

Simian virus 12 (strain wt100) (SV-12) (Baboon polyomavirus 1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAALALLGDLVATVSEAAAATGFSVAEIAAGEAAAAIEVQIASLATVEGITSTEAIAAIG LTPQTYAVITGAPGAIAGIAALVQTVSGVSSVAQVGYKFFSEWDHKISTVGLNQQPGMAL ELFNPEDYDILFPGVNTFVNNIQYLDPRHWGPTLFSAISQAFWHLVRDDLPRLTSQEIER RTQRFFRDSLAKFLEETTWTIVNAPINLYNSIQNYYSALSPIRPSMVRQVAEREGTQVTF GHSYSQSIDDADSIEEVTQRLDLRNKEANVHSGEFIEKTLAPGGANQRIAPQWMLPLLLG LYGTVTPALEAYEDAPSKKKRRMSRGSSQKAKGPRASSKTSYKRRRRSTRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-100 1x 100 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-500 1x 500 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details