Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS)

This Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Histidine protein kinase saeS, EC= 2.7.13.3, Sensor protein saeS, Staphylococcus exoprotein expression protein S

UniProt

Q6GBC5

Expression Region

1-351

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLSIRSQIIIGVVSSILLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCSEIDAFYQYRTPLE RILTNLLDNALKFSNVGSRIDINISENKDQDTIDIAISDEGIGIIPELQERIFERTFRVE NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD200R Recombinant monoclonal antibody (OX108) (Mouse IgG1κ)
ENZ-ABS421-0200 200 µg

CD200R Recombinant monoclonal antibody (OX108) (Mouse IgG1κ)

Sign In for Pricing
View Details
Mouse Ap1g1 Pre-designed siRNA Set A
SI100730A 1 Each

Mouse Ap1g1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PC5/6 Lentiviral Activation Particles (m)
sc-422143-LAC 200 µL

PC5/6 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Integrin Alpha V + Beta 5 Antibody Cy3 Conjugated
C02684Cy3 100 µL

Integrin Alpha V + Beta 5 Antibody Cy3 Conjugated

Sign In for Pricing
View Details
Olfr1494 (m) -PR
sc-150615-PR 10 µM - 20 µL

Olfr1494 (m) -PR

Sign In for Pricing
View Details
MPST Rabbit Polyclonal Antibody
orb1879514-01 30 µL

MPST Rabbit Polyclonal Antibody

Sign In for Pricing
View Details