Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS)

This Recombinant Staphylococcus aureus Histidine protein kinase saeS (saeS) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Histidine protein kinase saeS, EC= 2.7.13.3, Sensor protein saeS, Staphylococcus exoprotein expression protein S

UniProt

Q840P7

Expression Region

1-351

Origin

Staphylococcus aureus (strain Newman)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLSIRSQIIIGVVSSIPLTSTILAIAYILMWFNGHMTLTLTLTTIITSCLTLLICSIFI NPLIQKIKQFNIKTKQFANGNYASNDKTFNSPKEIYELNQSFNKMASEITQQMNQIKSEQ QEKTELIQNLAHDLKTPLASIISYSEGLRDGIITKDHEIKESYDILIKQANRLSTLFDDM THIITLNTGKTYPPELIQLDQLLVSILQPYEQRIKHENRTLEVNFCNEIDAFYQYRTPLE RILTNLLDNALKFSNVGSRIDINISENEDQDTIDIAISDEGIGIIPELQERIFERTFRVE NSRNTKTGGSGLGLYIANELAQQNNAKISVSSDIDVGTTMTVTLHKLDITS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse MDC/CCL22 (Macrophage-Derived Chemokine) ELISA Kit
E-MSEL-M0074-01 24 Tests

Mini Sample Mouse MDC/CCL22 (Macrophage-Derived Chemokine) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse MDC/CCL22 (Macrophage-Derived Chemokine) ELISA Kit
E-MSEL-M0074-02 48 Tests

Mini Sample Mouse MDC/CCL22 (Macrophage-Derived Chemokine) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse MDC/CCL22 (Macrophage-Derived Chemokine) ELISA Kit
E-MSEL-M0074-03 96 Tests

Mini Sample Mouse MDC/CCL22 (Macrophage-Derived Chemokine) ELISA Kit

Sign In for Pricing
View Details
3-Chlorophthalic Anhydride
TRC-C380578-500MG 500 mg

3-Chlorophthalic Anhydride

Sign In for Pricing
View Details
Rpl37a (NM_009084) Mouse Tagged ORF Clone
MG200237 10 µg

Rpl37a (NM_009084) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BBS4 (Center) Rabbit Polyclonal Antibody
AP14206PU-N 400 µL

BBS4 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details